PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003348-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family EIL
Protein Properties Length: 550aa    MW: 60027.9 Da    PI: 5.5497
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003348-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3198.94.1e-61551741123
                      XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                      +el++rmw+d+mllk+lke++k++   ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+LraW
  AHYPO_003348-RA  55 DELERRMWRDRMLLKKLKEQSKDKA--KEG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRAW 145
                      79*********************65..888.*************************************************************** PP

                      XXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3  95 Wkekvefdrngpaaiskyqaknlilsges 123
                      Wkekv+fdrngpaaiskyqa++ ++ ++ 
  AHYPO_003348-RA 146 WKEKVRFDRNGPAAISKYQADHSMPVDDT 174
                      *********************99987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.5E-5755175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MMSKMNFLED IGFCSNLEFF APPPQSAVAE VDAGRDGEPE GAVDEDYSDD EVDVDELERR  60
MWRDRMLLKK LKEQSKDKAK EGVDAAKQRQ SQEQARRKKM SRAQDGILKY MLKMMEVCKA  120
QGFVYGIIPE KGKPVSGASD NLRAWWKEKV RFDRNGPAAI SKYQADHSMP VDDTKPQNIN  180
LFNFGVGAPN HILTSPIKGE VIDTNAADFP EKRKQPTPGS HMVIDQKIFV CEYSQCPYGD  240
TRLGFLDRNS RNNHQLNCQY RYGSSALGVG VTNFQGNNSE PANFATSFAQ HEKLPVQSEN  300
QSSANFNVNG LGLPEDGQNL ISSLMTVYDT SPVLTSNKNV NLGSANFTEN NQMGGTFVGQ  360
GGVFGNGVSQ GMSVNSVKDH NQAQPKVAQF QLDNGFLGQA MPPMNVGNNI PQQKLQFQMG  420
GTGFQGPKVN QPGNNMGGSR VAMENSFSGQ RTMPGGNVSQ GSNMGGSRIA MENSFSGQRT  480
MPGGNGNNMA GSVLQSNTMQ MDNCRGFDAS FGMTLNDNIA DFGYGGLPFN LSTVDFDQLS  540
RQDSSIWNL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694878.11e-162PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246066e-74EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0J8E4K41e-162A0A0J8E4K4_BETVU; Uncharacterized protein
STRINGBra035746.1-P1e-99(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.13e-64EIL family protein